|
|
|
|
|
| YaniraBlancato's free sex chat | YaniraBlancato's profile page |
|
| Age : 19 |
Category : Hot Flirt |
| Weight : N/A |
Subcategory : Big_Tits |
| Sexual pref : bisexual |
Build : bbw |
| Ethnicity : white |
Eyecolor : brown |
| Height : N/A |
Haircolor : brown |
| Breast size : normal |
Hair length : shoulder_length |
| Languages : English,Spanish |
| Host Profile: My name is Mary, and my life
smells a bit like hay, dog
fur, and hope. If you were
looking for me in a crowd,
you'd probably spot me by the
paw prints on my jeans (yes,
it's my permanent accessory)
or the treat pouch in my
pocket, ready for any random
tail I might meet. My everyday
soundtrack isn't office
silence, but a whole chorus of
sounds: from purring and happy
squeaks to the nervous chirps
of a rescued bird. I'm a
veterinary rehabilitator (or
in simpler terms, a "Dr.
Dolittle for the lost
causes"). My job and my
greatest passion is helping
those who've been abandoned or
hurt, giving them a chance to
trust again and find a new
home. |
| What turns me on : animals, detectives, movies |
| What turns me off : angry people, long waits |
|
|
|
|
|
|
| KeylaVanis's free sex chat | KeylaVanis's profile page |
|
| Age : 32 |
Category : Girls |
| Weight : N/A |
Subcategory : Big_Tits |
| Sexual pref : straight |
Build : athletic |
| Ethnicity : white |
Eyecolor : brown |
| Height : N/A |
Haircolor : brown |
| Breast size : big |
Hair length : long |
| Languages : English,Spanish |
| Host Profile: in an age where
communicationis at everyone's
reach i truly believe we lost
the ability to truly connect,
and yet i am here trying to
change all that, trying to
prove different, i stand
before you with an open heart
and promising that i will not
judge. |
| What turns me on : travel, chocolate,dogs... |
| What turns me off : we'll get u started: Monday
mornings. what other things do
u dislike? |
|
|
|
|
|
|
| EvaCreek's free sex chat | EvaCreek's profile page |
|
| Age : 29 |
Category : Girls |
| Weight : N/A |
Subcategory : Big_Tits |
| Sexual pref : bisexual |
Build : curvy |
| Ethnicity : white |
Eyecolor : green |
| Height : N/A |
Haircolor : black |
| Breast size : big |
Hair length : long |
| Languages : English,French,Italian,Spanish |
| Host Profile: Hi, I'm Eva. I am interested
in exploring the dark corners
of human passions. With me,
you can free yourself from the
need for control and allow
yourself to focus on feelings.
Or I can be your support, your
energy, your inspiration. I
may seem angry at first
glance, but that's because I'm
kind and sensual. We can
create tension, lightning
between us or keep each other
warm. I have many sides,
choose which one you want to
open. |
| What turns me on : I love the connection between
people, it's much more
interesting. I am honest with
you, and I will not do what I
do not like, I prefer to have
sincere pleasure here and give
it to you. Among other things,
I am fascinated by bdsm, dirty
talk, deep, detailed fantasies
and building close
relationships |
| What turns me off : I do not like superficiality
and consumer attitude. I am
more than you can see. |
|
|
|
|
|
|
| Kayla's free sex chat | Kayla's profile page |
|
| Age : 43 |
Category : Girls |
| Weight : N/A |
Subcategory : Big_Tits |
| Sexual pref : bisexual |
Build : skinny |
| Ethnicity : white |
Eyecolor : brown |
| Height : N/A |
Haircolor : black |
| Breast size : big |
Hair length : long |
| Languages : English,Spanish |
| Host Profile: I can describe myself as sexy,
classy, sassy even i am sure
those words are not all. Feel
free to talk to me and
discover more and more and i
would love to do the same with
you. I like romance but i like
rough too, the key is your
mind, do you dare to unlock
the door that keeps up away?
Tell me what side of me do you
love the most! ^^ |
| What turns me on : Mmm hard to tell you. I love
to know new people. I love to
talk and discover stories, to
make friends. feel free to
write me^^ |
| What turns me off : Please don t be rude, or
impolite, i am a lady i want
some nice treatment from you. |
|
|
|
|
|
|
| EddieFris's free sex chat | EddieFris's profile page |
|
| Age : 23 |
Category : Fetish-SM |
| Weight : N/A |
Subcategory : Big_Tits |
| Sexual pref : bisexual |
Build : medium |
| Ethnicity : white |
Eyecolor : brown |
| Height : N/A |
Haircolor : N/A |
| Breast size : normal |
Hair length : shoulder_length |
| Languages : English,Spanish |
| Host Profile: weird underground femdom,
Playful domme |
| What turns me on : ✔ humiliation
✔ feminization
✔ training (how to be whore,
doll)
✔ control toys
✔ celibacy control
✔ cuckolds (i have a bf)
✔ CEI (one of my favourite,
i have a lot of tasks
✔ SPH commands (long-term
tasks with report, I need
results, not one time
commands)
✔ findom service and
draining (dangerous, im always
hungry)
✔ cage control session |
| What turns me off : fake, greedy n unwotrhy
slaves |
|
|
|
|
|
|
| AlexaFetish's free sex chat | AlexaFetish's profile page |
|
| Age : 27 |
Category : Fetish-SM |
| Weight : N/A |
Subcategory : 18_22 |
| Sexual pref : bisexual |
Build : athletic |
| Ethnicity : white |
Eyecolor : green |
| Height : N/A |
Haircolor : fire_red |
| Breast size : big |
Hair length : shoulder_length |
| Languages : English,Spanish |
| Host Profile: I am a commanding Mistress,
draped in sleek leather and
glossy latex, my curves
accentuated by daring nylon
catsuits. My presence is
amplified by towering
high-heeled boots, 7-inch
stilettos, elegant pumps, and
strappy sandals that demand
attention. With vibrant red
hair and makeup that’s both
fierce and flawless, I embody
power and allure. Dare to
kneel before me, or are you
too weak to handle my untamed
fire? |
| What turns me on : I crave a man who can set my
soul ablaze, make my heart
pound with desire, and leave
me quivering in ecstasy. I am
a Mistress—bold, untamed,
and the queen of my own
passions. Do you have the
courage to submit to me or
even meet my gaze? Prove
you’re worthy, or step
back—the choice is yours! |
| What turns me off : I rule my domain with
precision and expect
unwavering respect.
Disobedience, such as ignoring
my room’s rules or wasting
my precious time, is utterly
unacceptable and will not be
tolerated. Kneel before me
with devotion, or prove
yourself unworthy—choose
wisely. |
|
|
|
|
|
|
| EllieSin's free sex chat | EllieSin's profile page |
|
| Age : 29 |
Category : Girls |
| Weight : N/A |
Subcategory : White |
| Sexual pref : bisexual |
Build : athletic |
| Ethnicity : white |
Eyecolor : brown |
| Height : N/A |
Haircolor : brown |
| Breast size : big |
Hair length : long |
| Languages : English,Spanish |
| Host Profile: Welcome in my room, the place
that you can find desire, lust
and erotic times. For those
who don't know me already,
don't be fooled by the serious
look on my face sometimes, i
love to stay authentic and
genuine and not fake my mood.
Being myself is one of my best
qualities! What i can
guarantee is that you'll
laugh, have fun and get kinky
at the same time |
| What turns me on : People that show their honest
feelings, Long walks,
gentlemen, summer and of
course the beach. |
| What turns me off : Two faced people, liars,
condescending people |
|
|
|
|
|
|
| AnaKozlov's free sex chat | AnaKozlov's profile page |
|
| Age : 26 |
Category : Girls |
| Weight : N/A |
Subcategory : 18_22 |
| Sexual pref : bisexual |
Build : athletic |
| Ethnicity : latin_american |
Eyecolor : brown |
| Height : N/A |
Haircolor : fire_red |
| Breast size : normal |
Hair length : short |
| Languages : English,Spanish |
| Host Profile: My show is all about control,
seduction, and power. I love
watching you surrender
slowly, willingly as my words
and my body take over your
mind. I'll guide you, tease
you, reward you... or punish
you, if that's what you
deserve. |
| What turns me on : Obedience, eye contact, and
confidence mixed with
submission.
I love when you listen, follow
instructions, and beg for
more.
The more control I take, the
deeper your pleasure goes. |
| What turns me off : I don't like lies; I've always
believed that someone who lies
can do anything. |
|
|
|
|
|
|
| AuroraDurand's free sex chat | AuroraDurand's profile page |
|
| Age : 18 |
Category : Girls |
| Weight : N/A |
Subcategory : Blonde |
| Sexual pref : bisexual |
Build : curvy |
| Ethnicity : latin_american |
Eyecolor : green |
| Height : N/A |
Haircolor : brown |
| Breast size : big |
Hair length : long |
| Languages : English,Spanish |
| Host Profile: I am a friendly, supportive
and very outgoing person. I
like to connect with others
through sincerity and loyalty,
always trying to provide good
energy to those around me. I
really enjoy the little things
in life, like reading a good
book, listening to music and
letting myself be carried away
by the rhythm when I dance. I
am also passionate about the
world of beauty: doing
manicures and working as a
lash artist is something that
I love because it allows me to
highlight the beauty of each
person. In my free time I
enjoy painting, drawing and
exploring my creativity. I
love traveling, discovering
new places and contemplating
sunsets that fill the soul
with tranquility. Photography
and nature also hold a special
place in my life. I love going
to the movies, going out to
dinner, shopping or just
relaxing watching series. But,
without a doubt, one of the
moments that I value most is
spending quality time with my
family, creating memories and
sharing moments that make life
even more special |
| What turns me on : I am a versatile, daring and
very playful woman. I like to
explore the chemistry and
intensity of the moment,
letting myself be carried away
by the connection and
sensations. I enjoy role
plays, provocative looks and
words that ignite the
imagination. I love living
intense experiences, full of
mischief, passion and
complicity. |
| What turns me off : I am a daring person who
enjoys exploring intense and
different experiences. I like
trust and complicity to take
each moment to another level,
without fear of the forbidden
or the unconventional. I am
attracted to strong
sensations, unfiltered games
and experiences where
chemistry and provocation say
it all. |
|
|
|
|
|
|
| LianaRogers's free sex chat | LianaRogers's profile page |
|
| Age : 23 |
Category : Girls |
| Weight : N/A |
Subcategory : Big_Tits |
| Sexual pref : straight |
Build : medium |
| Ethnicity : latin_american |
Eyecolor : brown |
| Height : N/A |
Haircolor : blonde |
| Breast size : normal |
Hair length : shoulder_length |
| Languages : English,French,Italian,Spanish |
| Host Profile: Blonde, with curves that
attract attention and a look
that knows exactly what she
wants. I love to slowly
provoke, play with the
imagination and make every
second with me a small danger
that you won't want to escape.
I'm sweet when I want to...
but also very naughty when I
feel comfortable. I like the
tension, the long looks, the
knowing smiles and that moment
when you know that something
exciting is about to happen. |
| What turns me on : Flirting, intense looks, and
the tension you feel before
something exciting Flirting,
intense looks, and the tension
you feel before something
exciting |
| What turns me off : the trafic |
|
|
|
|
|
|
|
|
|
Top searched
iranianiran00pussycumingbarbielatinaxxarabplayfullpampersianasmileadayjgcfcherrylxstrawberry25bettertryfoxyandreexxxanemariexxxromanianbeneaspermmyfacecherryluvxxxxxpussysquirttmiavongasianpussy4u1 or 11alluregirlprettypassiondubaiqutieangelladyboymissyjoliefresasweetoxsamanthaxoqutieangelxxxthumbelina18kirabeeorder by 100julie bowenmitsukaprettyleylacypriotpersian wet ...shajraasianlisahotttiranipetitstarlettefarsievelynwowipersiandirty feetfoxyboobsgirlsweetlindabblilazaisha lee and 11missalexya1flawlessgrace20cuteherminiejgcfsgslvigr...saramimirandaalena snowlucyand 1111 or 0x500x50small europexmarielllaxhttpwwwpregn...latinangelhotxxsweetxlatinxxjulie bowen ...sweetlikecan...showxxx
|